PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI03G01730.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MIKC_MADS
Protein Properties Length: 464aa    MW: 52361 Da    PI: 10.439
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI03G01730.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF93.41.1e-29186236151
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                      krien + rqvtfskRrng+lKKA+ELSvLCdaeva+i+fs++gklye++s
  OMERI03G01730.1 186 KRIENPTSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSPRGKLYEFAS 236
                      79***********************************************86 PP

2K-box69.11.5e-23313406699
            K-box   6 gksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                      g+++ +++ e+ + +++ L k++e L++ +R+llGe+L+++s++eL++Le +Le+sl +iR +K++ll eq+ +l++ke +l+++n++Lr k +
  OMERI03G01730.1 313 GNKTVQQDIEQVKADADGLAKKLEALETYKRKLLGEKLDECSIEELHSLEVKLERSLISIRGRKTKLLEEQVAKLREKEMKLRKDNEELRDKCK 406
                      4557788899********************************************************************************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004329.8E-41178237IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.595178238IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.01E-28180238IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-30180200IPR002100Transcription factor, MADS-box
PROSITE patternPS003500180234IPR002100Transcription factor, MADS-box
CDDcd002651.88E-35180236No hitNo description
PfamPF003196.5E-27187234IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-30200215IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-30215236IPR002100Transcription factor, MADS-box
PfamPF014861.0E-23318405IPR002487Transcription factor, K-box
PROSITE profilePS5129713.315321411IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 464 aa     Download sequence    Send to blast
MGGSGTNFFP GWEISASLSL FVLPGCITTS APGCGGHDDD KKRKRNRTHS SCCRCLCPPL  60
PRWGGHYANK GKRQHPQGPK RKAEEEEVER RERGKKRERA SEQLGLRPNP TAPPPPLLAI  120
FGESPFADSQ IPFRFTTFAL SAAPPIGIKK KRAASLAPPP PPRRPQPFLW LVHRRSKMVR  180
GKTQMKRIEN PTSRQVTFSK RRNGLLKKAF ELSVLCDAEV ALIVFSPRGK LYEFASARKI  240
RSEKTEKTIF PRVAIELPSK QSHNFHKEIS CETGKTFAEA INFTHKMRSY SFTGQAGKKT  300
IERYRTYTKE NIGNKTVQQD IEQVKADADG LAKKLEALET YKRKLLGEKL DECSIEELHS  360
LEVKLERSLI SIRGRKTKLL EEQVAKLREK EMKLRKDNEE LRDKCKNQPP LSAPLTVRAE  420
DENPDRNINT TNDNMDVETE LFIGLPGRSR SSGAAEDSPA MPHS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D6e-16180236258Myocyte-specific enhancer factor 2A
3mu6_C6e-16180236258Myocyte-specific enhancer factor 2A
3mu6_B6e-16180236258Myocyte-specific enhancer factor 2A
3mu6_A6e-16180236258Myocyte-specific enhancer factor 2A
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18997RRERGKKRE
29399GKKRERA
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2104750.0AC210475.1 Oryza glaberrima clone OG_BBa0054O06, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0E0CUD90.0A0A0E0CUD9_9ORYZ; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14133379
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G51870.31e-42AGAMOUS-like 71